The Lancet IGF-1 and Muscle Growth Factor Peptides: Growth Factor Research in Muscle and Repair

Lancet Insights | 2026-06-25 | 11 min read

Analysis of IGF-1, IGF-1 LR3, and mechano growth factor (MGF) peptides for muscle research, covering growth factor mechanisms, satellite cell activation, and muscle hypertrophy research.

Growth Factor Peptides: IGF-1, LR3, and MGF

The Lancet has covered research on muscle growth and regeneration extensively, including growth factor biology. IGF-1 (insulin-like growth factor-1) and its variants represent key regulators of muscle growth, repair, and regeneration. This analysis examines IGF-1, IGF-1 LR3, and MGF for muscle research.

IGF-1 Biology

Structure and Isoforms

IGF-1 is a 70-amino acid peptide:

Human IGF-1 sequence: GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCGLRGYFER

Key properties:

  • Similar structure to insulin
  • High-affinity binding to IGF-1R
  • Lower affinity for insulin receptor
  • Multiple isoforms exist

Receptor Signalling

IGF-1 acts through the IGF-1 receptor:

#### Signalling Cascade

  • **IGF-1 binding**: Activates IGF-1R tyrosine kinase
  • **Receptor autophosphorylation**: Creates docking sites
  • **IRS-1 recruitment**: Insulin receptor substrate
  • **PI3K activation**: Generates PIP3
  • **Akt activation**: Central growth regulator
  • **mTORC1 activation**: Protein synthesis
  • **Protein synthesis**: Muscle growth

Physiological Effects

IGF-1 promotes muscle growth through:

  • **Anabolic effects**: Increases protein synthesis
  • **Anti-catabolic**: Inhibits protein breakdown
  • **Satellite cell activation**: Promotes muscle stem cells
  • **Hypertrophy**: Increases muscle fiber size
  • ** hyperplasia**: Increases nuclei in muscle

IGF-1 LR3

Structure

IGF-1 LR3 is a long-acting analogue:

Key modification:

  • Arginine at position 3 (instead of Glutamate)
  • Extended half-life (~20-30 hours vs ~12-15 hours)
  • Reduced binding to IGF-binding proteins
  • Increased potency

Research Applications

IGF-1 LR3 is preferred for:

  • Extended exposure
  • Reduced injection frequency
  • Higher relative potency
  • Muscle growth studies

Comparison to Native IGF-1

| Property | IGF-1 | IGF-1 LR3 | |----------|-------|-----------| | Half-life | 12-15 hours | 20-30 hours | | Relative potency | Baseline | Higher | | BP binding | Higher | Lower | | Research use | Reference | Often preferred |

Mechano Growth Factor (MGF)

Discovery and Structure

MGF is an IGF-1 splice variant:

MGF sequence: YPPKXPGSVNEFQLPSRSISSSGSRPGSQNR

Key features:

  • Different C-terminal sequence from IGF-1
  • Also called IGF-1Ec
  • Specifically expressed after exercise
  • Unique biological functions

Unique Mechanism

MGF differs from IGF-1:

#### Satellite Cell Activation

MGF specifically:

  • Activates satellite cells (muscle stem cells)
  • Promotes proliferation
  • Initiates muscle repair
  • Creates new muscle nuclei

#### Expression Pattern

MGF is:

  • Mechanically responsive
  • Rapidly expressed after exercise
  • Tissue-specific (muscle)
  • Different temporal pattern than IGF-1

Research Significance

MGF represents:

  • The "exercise-induced" growth factor
  • Bridges mechanical loading to growth
  • Important for muscle repair
  • Potential for muscle wasting conditions

Research Applications

In Vitro Studies

Growth factor research methods:

  • Muscle cell culture (C2C12, primary myotubes)
  • Satellite cell proliferation assays
  • Protein synthesis measurement (S6K1 phosphorylation)
  • IGF-1R signalling studies

In Vivo Research

Animal model protocols:

  • Muscle hypertrophy models
  • Muscle wasting/atrophy models
  • Satellite cell studies
  • Dosing: 20-100 μg/kg in rodents

Assessment Methods

Research endpoints:

  • Muscle weight (gastrocnemius, soleus)
  • Fiber cross-sectional area
  • Protein synthesis rates
  • Satellite cell number/activation

Quality Standards

Purity Requirements

Growth factor research:

  • HPLC purity ≥99.5%
  • Mass spectrometry verification
  • Accurate peptide quantification
  • Endotoxin testing
  • Batch-specific COA documentation

Stability Considerations

Growth factor stability:

  • Lyophilised: -20°C protected from light
  • Reconstituted: Use immediately or refrigerate
  • Avoid repeated freeze-thaw
  • Critical for activity

Combination Approaches

With Strength Training

Research explores:

  • MGF + resistance exercise
  • Timing considerations
  • Enhanced hypertrophic response
  • Mechanism studies

With Other Peptides

Growth hormone peptides:

  • IGF-1 LR3 + CJC-1295/GHRP
  • Enhanced GH axis effects
  • Complementary pathways
  • Under investigation

With Recovery Optimisation

Combinations for repair:

  • IGF-1 + TB-500
  • IGF-1 + BPC-157
  • Muscle repair protocols
  • Tissue healing approaches

Clinical Relevance

Muscle Wasting Conditions

Potential therapeutic applications:

  • Sarcopenia (age-related muscle loss)
  • Cancer cachexia
  • ICU-acquired weakness
  • Muscular dystrophies

Research Considerations

Clinical translation challenges:

  • Systemic IGF-1 effects
  • Safety concerns
  • IGF-1 binding protein interactions
  • Long-term safety data needed

Future Directions

Peptide Development

Novel approaches:

  • Long-acting IGF-1 analogues
  • MGF-specific formulations
  • Targeted delivery
  • Combination products

Research Needs

Areas for advancement:

  • Optimal dosing protocols
  • Delivery methods
  • Tissue-specific targeting
  • Safety optimisation

ZePeptide provides research-grade IGF-1 LR3, MGF, and related growth factor peptides with complete analytical documentation.

ZePeptide content is for lawful laboratory and in-vitro research sourcing. Products are not supplied for human or veterinary use.

Research peptide catalogSupplier checklistMore peptide guides